PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G382000.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 746aa    MW: 81513.6 Da    PI: 6.5123
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G382000.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM35.62.7e-112715418128
                 NAM  18 yLkkkvegkk...leleevikevdiykvePwdLpk.........kvkaeekewyfFskrdkkya.tgkrknra.....tksgyWkatgkdk 90 
                          L++k+ g k    +   +i+e++ y+++P dL +         + +++  +wyf ++++ +++  g+r++r      +++g W++  k+k
  Brast02G382000.3.p  27 LLRHKAVGGKpfpRSHRPFIHEANPYSSHPADLVRgrahapgtdRGDGRGGDWYFCFPSKYQETvAGRRAKRRsrtvgAQDGCWHSESKKK 117
                         5666655444443222235**************744566665432223444998755555444436777777535555669********** PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++ + +  ++     +   ++ + k ++t W+m e +l
  Brast02G382000.3.p 118 PIQD-RAYVTPFSYKMKVLENAKFKHQRTGWCMAEIQL 154
                         ***9.677777788888888999999*********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100512.91710168IPR003441NAC domain
SuperFamilySSF1019414.84E-1626168IPR003441NAC domain
PfamPF023651.2E-428153IPR003441NAC domain
Gene3DG3DSA:3.40.1160.104.9E-13230278IPR001048Aspartate/glutamate/uridylate kinase
PfamPF006962.8E-9230370IPR001048Aspartate/glutamate/uridylate kinase
SuperFamilySSF536331.83E-40230473IPR001048Aspartate/glutamate/uridylate kinase
PROSITE patternPS003240231239IPR018042Aspartate kinase, conserved site
Gene3DG3DSA:3.40.1160.104.9E-13318369IPR001048Aspartate/glutamate/uridylate kinase
Gene3DG3DSA:3.40.1160.106.9E-21381475IPR001048Aspartate/glutamate/uridylate kinase
PfamPF006969.3E-12381443IPR001048Aspartate/glutamate/uridylate kinase
SuperFamilySSF550212.37E-5480546No hitNo description
SuperFamilySSF550214.12E-7559635No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008652Biological Processcellular amino acid biosynthetic process
GO:0003677Molecular FunctionDNA binding
GO:0004072Molecular Functionaspartate kinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 746 aa     Download sequence    Send to blast
MSAPNSPTSE QLQTLTPDLR PSVFARLLRH KAVGGKPFPR SHRPFIHEAN PYSSHPADLV  60
RGRAHAPGTD RGDGRGGDWY FCFPSKYQET VAGRRAKRRS RTVGAQDGCW HSESKKKPIQ  120
DRAYVTPFSY KMKVLENAKF KHQRTGWCMA EIQLEENVEL VLCRVYRSPR PSSAARGERG  180
APAPPLIDQI SPCAGRISPA SGGSGAMSEL GKGWMIRCQS GAAAAAAADT VMKFGGSSIP  240
SAEGMKEAAS IVLSFPEGTP APVVVLSAMG KTTTNLLMAA DNALRWRTHK AWEIRELDAV  300
QELHLSTVDA LGLDRSIISG SLDELKQLLK HVALDHTLTP KTRDIILSHG ELMSTTIFSA  360
YLNKLGEGAQ QEWEWSAISN VGSGGSDLAA ISIARELRAR KIVVWKDVNG LFTCDPNVFE  420
SALPLPYLNF NEATALGFFA AQSMELALEI GIPVIVKSLY NPQAPGTMLT KTREMNESEL  480
TRIMLTSNLT MLDIKSTGAV DRSRFVTKAF SIFTKFGISV DHAVISQCEV LIILVPSKLL  540
SHESIQMQKL DVVIEELQQI AAVHALSHRS FISLIGTAEM STTILEKAFG ALTRINVKTQ  600
MSSHGSSKVM NIFLVVNDNE ATNCVEALHS EFVEKYLSEV HGADSEHNSS LVPVSSSVAA  660
SSGDKRKPDD EHRTQCLDTE TDDYHMDMRV LSGNFDNTLT FIAEEDFTND VEAVVVEHWS  720
LFAGEEEGVY VAPHTYQFLE GVTAP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cdq_A1e-11823163430484ASPARTOKINASE
2cdq_B1e-11823163430484ASPARTOKINASE
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562409.11e-141PREDICTED: aspartokinase 1, chloroplastic
SwissprotQ9LYU81e-118AK1_ARATH; Aspartokinase 1, chloroplastic
STRINGBRADI1G01800.11e-142(Brachypodium distachyon)